PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_113460_zztx.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 29111.1 Da    PI: 8.6069
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_113460_zztx.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.1e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+iifs++gkl+e++s
  Bv5_113460_zztx.t1  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLFEFCS 59
                        79***********************************************96 PP

2K-box94.51.8e-318617313100
               K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                         + +  ++e+ kLk ++e Lq++qR+llGedL +L +keL+qLe+qLe slk+iRs+K++++l+q+ el+k+e++l e+n++L kklee
  Bv5_113460_zztx.t1  86 DPQATYHEYLKLKTRVEFLQQSQRNLLGEDLAPLAIKELEQLEHQLELSLKQIRSTKSQHMLDQLAELRKREQALVENNRNLMKKLEE 173
                         468899*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.941161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002653.20E-44278No hitNo description
SuperFamilySSF554551.07E-32275IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-2587171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.78287177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVALIIFSN RGKLFEFCSS  60
SSMLKTIEKY QRCNYGALEA NGVLNDPQAT YHEYLKLKTR VEFLQQSQRN LLGEDLAPLA  120
IKELEQLEHQ LELSLKQIRS TKSQHMLDQL AELRKREQAL VENNRNLMKK LEESNPQFPQ  180
QLAWEGDNHQ DQQNIPFSRI PTHHQSSEGF FQPLCGNPPL QNGYHHLDST QISVATPSQN  240
LNGYNNVHGW ML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A8e-23751711101Developmental protein SEPALLATA 3
4ox0_B8e-23751711101Developmental protein SEPALLATA 3
4ox0_C8e-23751711101Developmental protein SEPALLATA 3
4ox0_D8e-23751711101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1298752e-62AF129875.1 Capsicum annuum MADS box transcription factor MADS1 (MADS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678363.10.0PREDICTED: MADS-box protein CMB1-like
SwissprotQ396855e-97CMB1_DIACA; MADS-box protein CMB1
TrEMBLA0A0J8CB490.0A0A0J8CB49_BETVU; Uncharacterized protein
STRINGVIT_17s0000g05000.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.14e-88MIKC_MADS family protein